PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT29472
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family NAC
Protein Properties Length: 236aa    MW: 26143 Da    PI: 9.7678
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT29472genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.81.5e-5191331128
       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvg 101
               lppGfrFhPtdeelv++yL+++++g ++ +  +i+e+d+yk++Pw+Lpk++  +ekewyfFs+rd+ky++g+r+nra+ sgyWkatg dk+v +   +   
  EMT29472   9 LPPGFRFHPTDEELVTHYLCRRCAGAPIAV-PIITEIDLYKFDPWQLPKMALYGEKEWYFFSPRDRKYPNGSRPNRAAGSGYWKATGADKPVGT--PKPLA 106
               79**************************99.88***************7767789*************************************99..7789* PP

       NAM 102 lkktLvfykgrapkgektdWvmheyrl 128
               +kk Lvfy g+apkgekt+W+mheyrl
  EMT29472 107 IKKALVFYAGKAPKGEKTNWIMHEYRL 133
               *************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.05E-615159IPR003441NAC domain
PROSITE profilePS5100559.6759159IPR003441NAC domain
PfamPF023656.3E-2710133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009611Biological Processresponse to wounding
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MSGGQELNLP PGFRFHPTDE ELVTHYLCRR CAGAPIAVPI ITEIDLYKFD PWQLPKMALY  60
GEKEWYFFSP RDRKYPNGSR PNRAAGSGYW KATGADKPVG TPKPLAIKKA LVFYAGKAPK  120
GEKTNWIMHE YRLADVDRSA RKKNSLRLDD WVLCRIYNKK GGMEKPASVD RKPAAMGGYG  180
GGPGAMSQPK ISEWERSFAS GGDPVNPAAG SMLEPNGGFG GDPLLQDILM YWGKPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-80616512174Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00121DAPTransfer from AT1G01720Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFN3968310.0FN396831.1 Triticum aestivum mRNA for NAC transcription factor (nac6D gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015698070.11e-128PREDICTED: LOW QUALITY PROTEIN: NAC domain-containing protein 48-like
SwissprotQ7F2L31e-117NAC48_ORYSJ; NAC domain-containing protein 48
TrEMBLM8CPM51e-174M8CPM5_AEGTA; NAC domain-containing protein 48
STRINGSb03g041920.11e-134(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34173782
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-103NAC family protein